Host Protein General Information

  Protein Name
Calmodulin-like protein 3
  Gene Name
CALML3
  Host Species
Homo sapiens
  Uniprot Entry Name
CALL3_HUMAN
  Protein Families
Calmodulin family
  External Link
NCBI Gene ID
810
Uniprot ID
P27482
Ensembl ID
ENSG00000179218
HGNC ID
1452
  Related KEGG Pathway
C-type lectin receptor signaling pathway hsa04625            Pathway Map 
Pertussis hsa05133            Pathway Map 
Tuberculosis hsa05152            Pathway Map 
Human cytomegalovirus infection hsa05163            Pathway Map 
Kaposi sarcoma-associated herpesvirus infection hsa05167            Pathway Map 
Human immunodeficiency virus 1 infection hsa05170            Pathway Map 
Ras signaling pathway hsa04014            Pathway Map 
Rap1 signaling pathway hsa04015            Pathway Map 
Calcium signaling pathway hsa04020            Pathway Map 
cGMP-PKG signaling pathway hsa04022            Pathway Map 
cAMP signaling pathway hsa04024            Pathway Map 
Phosphatidylinositol signaling system hsa04070            Pathway Map 
Oocyte meiosis hsa04114            Pathway Map 
Cellular senescence hsa04218            Pathway Map 
Adrenergic signaling in cardiomyocytes hsa04261            Pathway Map 
Vascular smooth muscle contraction hsa04270            Pathway Map 
Apelin signaling pathway hsa04371            Pathway Map 
Circadian entrainment hsa04713            Pathway Map 
Long-term potentiation hsa04720            Pathway Map 
Neurotrophin signaling pathway hsa04722            Pathway Map 
Dopaminergic synapse hsa04728            Pathway Map 
Olfactory transduction hsa04740            Pathway Map 
Phototransduction hsa04744            Pathway Map 
Inflammatory mediator regulation of TRP channels hsa04750            Pathway Map 
Insulin signaling pathway hsa04910            Pathway Map 
GnRH signaling pathway hsa04912            Pathway Map 
Estrogen signaling pathway hsa04915            Pathway Map 
Melanogenesis hsa04916            Pathway Map 
Oxytocin signaling pathway hsa04921            Pathway Map 
Glucagon signaling pathway hsa04922            Pathway Map 
Renin secretion hsa04924            Pathway Map 
Aldosterone synthesis and secretion hsa04925            Pathway Map 
Salivary secretion hsa04970            Pathway Map 
Gastric acid secretion hsa04971            Pathway Map 
Alzheimer disease hsa05010            Pathway Map 
Parkinson disease hsa05012            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
Amphetamine addiction hsa05031            Pathway Map 
Alcoholism hsa05034            Pathway Map 
Pathways in cancer hsa05200            Pathway Map 
Glioma hsa05214            Pathway Map 
Lipid and atherosclerosis hsa05417            Pathway Map 
Fluid shear stress and atherosclerosis hsa05418            Pathway Map 
  3D Structure
PDB ID: 1GGZ 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = 0.722311404 FZR = 1
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -3.459308575 FZR = 0.430001877
Ebola virus (strain VeroVP30) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver . MIST = 0.685515425 .

Protein Sequence Information

MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
    Click to Show/Hide