Host Protein General Information
| Protein Name |
Proteasome subunit beta type-4
|
Gene Name |
PSMB4
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
PSB4_HUMAN
|
||||||
| Protein Families |
Peptidase T1B family
|
||||||||
| Subcellular Location |
Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Proteasome | hsa03050 |
Pathway Map
|
|||||||
| Alzheimer disease | hsa05010 |
Pathway Map
|
|||||||
| Parkinson disease | hsa05012 |
Pathway Map
|
|||||||
| Amyotrophic lateral sclerosis | hsa05014 |
Pathway Map
|
|||||||
| Huntington disease | hsa05016 |
Pathway Map
|
|||||||
| Spinocerebellar ataxia | hsa05017 |
Pathway Map
|
|||||||
| Prion disease | hsa05020 |
Pathway Map
|
|||||||
| Pathways of neurodegeneration - multiple diseases | hsa05022 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Sindbis virus | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Sindbis virus (strain Toto1101) | 5'UTR - 3'UTR | RNA Info | Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 2 h | . | . |
| Dengue virus 2 (strain D2/SG/05K3295DK1/2005) | 3'UTR | RNA Info | RNA chromatography and quantitative mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Potential Drug(s) that Targets This Protein
| Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| BORTEZOMIB | . | 387447 | D0SH3I | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CARFILZOMIB | . | 11556711 | D00UVA | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MARIZOMIB | . | 11347535 | D0N0RN | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OPROZOMIB | . | 25067547 | D02BLD | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Sequence Information
|
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
Click to Show/Hide
|
