Host Protein General Information
Protein Name |
ADP-ribosylation factor-like protein 1
|
Gene Name |
ARL1
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
ARL1_HUMAN
|
||||||
Protein Families |
Small GTPase superfamily, Arf family
|
||||||||
Subcellular Location |
Golgi apparatus membrane
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -9.768368484 | FZR = 1.40212E-19 |
Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -0.479048175 | FZR = 1 |
Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 3 h | P = 0.0182677278358217 | . |
Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 1 h | P = 0.00901917258340337 | . |
Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 0.2 h | P = 0.000976125421345957 | . |
Protein Sequence Information
MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
Click to Show/Hide
|