Details of Protein

External Link
Protein Name	Basal cell adhesion molecule	Gene Name	BCAM
Host Species	Homo sapiens	Uniprot Entry Name	BCAM_HUMAN
Subcellular Location	Membrane; Single-pass type I membrane protein
	NCBI Gene ID	4059
	Uniprot ID	P50895
	Ensembl ID	ENSG00000187244
	HGNC ID	6722
3D Structure	PDB ID: 2PET FASTA Download 2D PNG Download PDB File Download

Virus Name	Binding Region	RNA Info	Detection Method	Infection Cell	Cell ID	Cell Originated Tissue	Infection Time	Interaction Score 1	Interaction Score 2
Encephalomyocarditis virus	5'UTR - 3'UTR	RNA Info	Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS)	HuH-7.5 Cells (Human hepatocellular carcinoma cell)	.	Liver	.	Z-score = -2.264962064	FZR = 1
Influenza A virus	5'UTR - 3'UTR	RNA Info	Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS)	HuH-7.5 Cells (Human hepatocellular carcinoma cell)	.	Liver	.	Z-score = -1.129981251	FZR = 1
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Wuhan-Hu-1/2019)	3'UTR	RNA Info	RNA-protein interaction detection (RaPID) assay & liquid chromatography with tandem mass spectrometry (LC-MS/MS)	HEK293T cells	.	Liver	48 h	Prot score = 16	.

MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC

Click to Show/Hide

Host Protein General Information

Full List of Virus RNA Interacting with This Protien

Protein Sequence Information