Protein Name
S-phase kinase-associated protein 1
  Gene Name
SKP1
  Host Species
Homo sapiens
  Uniprot Entry Name
SKP1_HUMAN
  Protein Families
SKP1 family
  External Link
NCBI Gene ID
6500
Uniprot ID
P63208
Ensembl ID
ENSG00000113558
HGNC ID
10899
  Related KEGG Pathway
Shigellosis hsa05131            Pathway Map 
Salmonella infection hsa05132            Pathway Map 
Human immunodeficiency virus 1 infection hsa05170            Pathway Map 
Pathways in cancer hsa05200            Pathway Map 
Cell cycle hsa04110            Pathway Map 
Oocyte meiosis hsa04114            Pathway Map 
Circadian rhythm hsa04710            Pathway Map 
Ubiquitin mediated proteolysis hsa04120            Pathway Map 
Protein processing in endoplasmic reticulum hsa04141            Pathway Map 
Wnt signaling pathway hsa04310            Pathway Map 
TGF-beta signaling pathway hsa04350            Pathway Map 
  3D Structure

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver . . .
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
    Click to Show/Hide