Host Protein General Information

  Protein Name
28S ribosomal protein S5
  Gene Name
MRPS5
  Host Species
Homo sapiens
  Uniprot Entry Name
RT05_HUMAN
  Protein Families
Universal ribosomal protein uS5 family
  Subcellular Location
Mitochondrion
  External Link
NCBI Gene ID
64969
Uniprot ID
P82675
Ensembl ID
ENSG00000144029
HGNC ID
14498
  Related KEGG Pathway
Ribosome hsa03010            Pathway Map 
  3D Structure
PDB ID: 3J9M 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -9.655493448 FZR = 4.22581E-19
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -2.949584575 FZR = 1
Human coronavirus OC43 (strain hCov-OC43/VR-759 Quebec/2019) Not Specified Virus Region RNA Info liquid chromatography with tandem mass spectrometry (LC-MS/MS) HCT-8 cells (Human ileocaecal adenocarcinoma cell) . Ileocecum 12h; 24; 36h; 48h p_value < 0.05; FDR < 10% .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/South Korea/KCDC03/2020) 5'UTR RNA Info Modified RNA antisense purification coupled with mass spectrometry (RAP-MS); label-free quantification (LFQ); liquid chromatography with tandem mass spectrometry (LC-MS/MS) Vero cells (epithelial kidney cells) . kidney 24 h adj. p value < 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) N region RNA Info RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) Huh7 cell line . Liver . P value < 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) Not Specified Virus Region RNA Info UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) Calu-3 cells (Human lung cancer cells) . Lung 24 h adj.P.Val = 0.030 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h . .

Protein Sequence Information

MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPYASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT
    Click to Show/Hide