Host Protein General Information
| Protein Name |
Ribosome maturation protein SBDS
|
Gene Name |
SBDS
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
SBDS_HUMAN
|
||||||
| Protein Families |
SDO1/SBDS family
|
||||||||
| Subcellular Location |
Cytoplasm; Nucleus
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Ribosome biogenesis in eukaryotes | hsa03008 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -12.12450528 | FZR = 8.17001E-31 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -6.994497257 | FZR = 3.14E-09 |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) | 5'UTR | RNA Info | PrismNet; pull-down western (STAR methods); mass spectrometry | Huh7.5.1 cells | . | Liver | 30 h | Affinity = 0.94 | . |
Protein Sequence Information
|
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Click to Show/Hide
|
