Host Protein General Information

  Protein Name
Cell division control protein 42 homolog
  Gene Name
CDC42
  Host Species
Homo sapiens
  Uniprot Entry Name
CDC42_HUMAN
  Protein Families
Small GTPase superfamily, Rho family, CDC42 subfamily
  EC Number
3.6.5.2
  Subcellular Location
Cell membrane
  External Link
NCBI Gene ID
998
Uniprot ID
P60953
Ensembl ID
ENSG00000089280
HGNC ID
1736
  Related KEGG Pathway
Chemokine signaling pathway hsa04062            Pathway Map 
T cell receptor signaling pathway hsa04660            Pathway Map 
Fc gamma R-mediated phagocytosis hsa04666            Pathway Map 
Leukocyte transendothelial migration hsa04670            Pathway Map 
Bacterial invasion of epithelial cells hsa05100            Pathway Map 
Epithelial cell signaling in Helicobacter pylori infection hsa05120            Pathway Map 
Pathogenic Escherichia coli infection hsa05130            Pathway Map 
Shigellosis hsa05131            Pathway Map 
Salmonella infection hsa05132            Pathway Map 
Yersinia infection hsa05135            Pathway Map 
Human papillomavirus infection hsa05165            Pathway Map 
MAPK signaling pathway hsa04010            Pathway Map 
Ras signaling pathway hsa04014            Pathway Map 
Rap1 signaling pathway hsa04015            Pathway Map 
Endocytosis hsa04144            Pathway Map 
Axon guidance hsa04360            Pathway Map 
VEGF signaling pathway hsa04370            Pathway Map 
Focal adhesion hsa04510            Pathway Map 
Adherens junction hsa04520            Pathway Map 
Tight junction hsa04530            Pathway Map 
Neurotrophin signaling pathway hsa04722            Pathway Map 
Regulation of actin cytoskeleton hsa04810            Pathway Map 
GnRH signaling pathway hsa04912            Pathway Map 
Non-alcoholic fatty liver disease hsa04932            Pathway Map 
AGE-RAGE signaling pathway in diabetic complications hsa04933            Pathway Map 
Pathways in cancer hsa05200            Pathway Map 
Viral carcinogenesis hsa05203            Pathway Map 
Proteoglycans in cancer hsa05205            Pathway Map 
Renal cell carcinoma hsa05211            Pathway Map 
Pancreatic cancer hsa05212            Pathway Map 
Lipid and atherosclerosis hsa05417            Pathway Map 
  3D Structure
PDB ID: 1A4R 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -6.731783481 FZR = 1.16144E-08
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -0.388707323 FZR = 1
Influenza A virus (strain California/7/2004 (H3N2)) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 0.000923885592436679 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h P = 6.57776343267714e-05 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 3.23924127896155e-05 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h P = 0.000134687073250936 .

Protein Sequence Information

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
    Click to Show/Hide