Host Protein General Information
Protein Name |
PP-1A
|
Gene Name |
PPP1CA
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
PP1A_HUMAN
|
||||||
Protein Families |
PPP phosphatase family
|
||||||||
EC Number |
3.1.3.16
|
||||||||
Subcellular Location |
Cytoplasm
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
Related KEGG Pathway | |||||||||
Platelet activation | hsa04611 |
Pathway Map ![]() |
|||||||
Herpes simplex virus 1 infection | hsa05168 |
Pathway Map ![]() |
|||||||
Proteoglycans in cancer | hsa05205 |
Pathway Map ![]() |
|||||||
Diabetic cardiomyopathy | hsa05415 |
Pathway Map ![]() |
|||||||
Oocyte meiosis | hsa04114 |
Pathway Map ![]() |
|||||||
Cellular senescence | hsa04218 |
Pathway Map ![]() |
|||||||
Regulation of actin cytoskeleton | hsa04810 |
Pathway Map ![]() |
|||||||
Focal adhesion | hsa04510 |
Pathway Map ![]() |
|||||||
Adrenergic signaling in cardiomyocytes | hsa04261 |
Pathway Map ![]() |
|||||||
Vascular smooth muscle contraction | hsa04270 |
Pathway Map ![]() |
|||||||
Insulin resistance | hsa04931 |
Pathway Map ![]() |
|||||||
Insulin signaling pathway | hsa04910 |
Pathway Map ![]() |
|||||||
Oxytocin signaling pathway | hsa04921 |
Pathway Map ![]() |
|||||||
Long-term potentiation | hsa04720 |
Pathway Map ![]() |
|||||||
Dopaminergic synapse | hsa04728 |
Pathway Map ![]() |
|||||||
Inflammatory mediator regulation of TRP channels | hsa04750 |
Pathway Map ![]() |
|||||||
cGMP-PKG signaling pathway | hsa04022 |
Pathway Map ![]() |
|||||||
cAMP signaling pathway | hsa04024 |
Pathway Map ![]() |
|||||||
Hippo signaling pathway | hsa04390 |
Pathway Map ![]() |
|||||||
Amphetamine addiction | hsa05031 |
Pathway Map ![]() |
|||||||
Alcoholism | hsa05034 |
Pathway Map ![]() |
|||||||
mRNA surveillance pathway | hsa03015 |
Pathway Map ![]() |
|||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Dengue virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Zika virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 6.709481562 | FZR = 1.34573E-08 |
Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 1.627342272 | FZR = 1 |
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) | Not Specified Virus Region | RNA Info | ChIRP-MS | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) | . | Liver | 48 h | FDR <= 0.05 | . |
Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 1.231 |
Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 0 | MIST = 0.594 |
Potential Drug(s) that Targets This Protein
Drug Name | DrunkBank ID | Pubchem ID | TTD ID | REF | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
CANTHARIDIN | . | 5944 | D0Z2RA | DGIdb | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
DEMETHYL-CANTHARIDIN | . | 93004 | D0W4IL | DGIdb |
Protein Sequence Information
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Click to Show/Hide
|