Protein Name
Small nuclear ribonucleoprotein Sm D3
  Gene Name
SNRPD3
  Host Species
Homo sapiens
  Uniprot Entry Name
SMD3_HUMAN
  Protein Families
SnRNP core protein family
  Subcellular Location
Cytoplasm; cytosol
  External Link
NCBI Gene ID
6634
Uniprot ID
P62318
Ensembl ID
ENSG00000100028
HGNC ID
11160
  Related KEGG Pathway
Systemic lupus erythematosus hsa05322            Pathway Map 
Spliceosome hsa03040            Pathway Map 
  3D Structure

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -22.94233517 FZR = 2.3338E-113
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -11.23224428 FZR = 3.74E-26
Ebola virus (strain VeroVP30) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver . MIST = 0.986174964 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) Not Specified Virus Region RNA Info ChIRP-MS Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) . Liver 48 h FDR <= 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) 5'UTR RNA Info RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) Huh7 or Calu-3 cell line . Liver . P value < 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) 3'UTR RNA Info RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) Huh7 or Calu-3 cell line . Liver . P value < 0.05 .
Dengue virus 2 (strain D2/SG/05K3295DK1/2005) 3'UTR RNA Info RNA chromatography and quantitative mass spectrometry HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
    Click to Show/Hide