Protein Name
Glutathione S-transferase omega-1
  Gene Name
GSTO1
  Host Species
Homo sapiens
  Uniprot Entry Name
GSTO1_HUMAN
  Protein Families
GST superfamily, Omega family
  EC Number
1.20.4.2; 1.8.5.1; 2.5.1.18
  Subcellular Location
Cytoplasm; cytosol
  External Link
NCBI Gene ID
9446
Uniprot ID
P78417
Ensembl ID
ENSG00000148834
HGNC ID
13312
  Related KEGG Pathway
Platinum drug resistance hsa01524            Pathway Map 
Pathways in cancer hsa05200            Pathway Map 
Chemical carcinogenesis - DNA adducts hsa05204            Pathway Map 
Chemical carcinogenesis - receptor activation hsa05207            Pathway Map 
Chemical carcinogenesis - reactive oxygen species hsa05208            Pathway Map 
Hepatocellular carcinoma hsa05225            Pathway Map 
Fluid shear stress and atherosclerosis hsa05418            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Glutathione metabolism hsa00480            Pathway Map 
Metabolism of xenobiotics by cytochrome P450 hsa00980            Pathway Map 
Drug metabolism - cytochrome P450 hsa00982            Pathway Map 
Drug metabolism - other enzymes hsa00983            Pathway Map 
  3D Structure

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -4.691649208 FZR = 0.001363188
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -2.903145119 FZR = 1
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Drug Name DrunkBank ID Pubchem ID TTD ID REF
carfilzomib . 11556711  D00UVA  DrugCentral
ethacrynic acid . 3278  D06TNL  DrugCentral
omeprazole . 4594  D01XNB  DrugCentral
rifampicin . 135398735  D0G3DL  DrugCentral

MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
    Click to Show/Hide