Host Protein General Information

  Protein Name
Inorganic pyrophosphatase
  Gene Name
PPA1
  Host Species
Homo sapiens
  Uniprot Entry Name
IPYR_HUMAN
  Protein Families
PPase family
  EC Number
3.6.1.1
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
5464
Uniprot ID
Q15181
Ensembl ID
ENSG00000180817
HGNC ID
9226
  Related KEGG Pathway
Oxidative phosphorylation hsa00190            Pathway Map 
  3D Structure
PDB ID: 6C45 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -9.985636909 FZR = 1.62425E-20
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = 3.69264612 FZR = 0.18331645
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) Not Specified Virus Region RNA Info ChIRP-MS Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) . Liver 48 h FDR <= 0.05 .

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
ALCOHOL . 702  D00AMQ  DGIdb

Protein Sequence Information

MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
    Click to Show/Hide