Host Protein General Information
| Protein Name |
Translocon-associated protein subunit gamma
|
Gene Name |
SSR3
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
SSRG_HUMAN
|
||||||
| Protein Families |
TRAP-gamma family
|
||||||||
| Subcellular Location |
Endoplasmic reticulum membrane; Multi-pass membrane protein
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Protein processing in endoplasmic reticulum | hsa04141 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus | 5'UTR - 3'UTR | RNA Info | UV cross-linking (UVX) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -6.560458838 | FZR = 3.61014E-08 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -0.862909284 | FZR = 1 |
| Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
Protein Sequence Information
|
MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK
Click to Show/Hide
|
