Host Protein General Information

  Protein Name
D-3-phosphoglycerate dehydrogenase
  Gene Name
PHGDH
  Host Species
Homo sapiens
  Uniprot Entry Name
SERA_HUMAN
  Protein Families
D-isomer specific 2-hydroxyacid dehydrogenase family
  EC Number
1.1.1.37; 1.1.1.399; 1.1.1.95
  External Link
NCBI Gene ID
26227
Uniprot ID
O43175
Ensembl ID
ENSG00000132591
HGNC ID
8923
  Related KEGG Pathway
Glycine, serine and threonine metabolism hsa00260            Pathway Map 
Cysteine and methionine metabolism hsa00270            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
Carbon metabolism hsa01200            Pathway Map 
Biosynthesis of amino acids hsa01230            Pathway Map 
  3D Structure
PDB ID: 2G76 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = 8.404078267 FZR = 3.58788E-14
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -1.320674985 FZR = 1
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h . .

Protein Sequence Information

MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
    Click to Show/Hide