Host Protein General Information

  Protein Name
Small nuclear ribonucleoprotein F
  Gene Name
SNRPF
  Host Species
Homo sapiens
  Uniprot Entry Name
RUXF_HUMAN
  Protein Families
SnRNP Sm proteins family, SmF/LSm6 subfamily
  Subcellular Location
Cytoplasm; cytosol
  External Link
NCBI Gene ID
6636
Uniprot ID
P62306
Ensembl ID
ENSG00000151914
HGNC ID
11162
  Related KEGG Pathway
Spliceosome hsa03040            Pathway Map 
  3D Structure
PDB ID: 3CW1 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -5.587953616 FZR = 1.33491E-05
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = 4.094401575 FZR = 0.037458525
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) 5'UTR RNA Info RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) Huh7 or Calu-3 cell line . Liver . P value < 0.05 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver 28 h MIST = 1.85 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver 28 h . .

Protein Sequence Information

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
    Click to Show/Hide