Home
Search 
BLAST
Manual
DownloadHost Protein General Information
| Protein Name |
Aldehyde dehydrogenase 1A1
|
Gene Name |
ALDH1A1
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
AL1A1_HUMAN
|
||||||
| Protein Families |
Aldehyde dehydrogenase family
|
||||||||
| EC Number |
1.2.1.19; 1.2.1.28; 1.2.1.3; 1.2.1.36
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus | 5'UTR - 3'UTR | RNA Info | UV cross-linking (UVX) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -5.972826357 | FZR = 1.45503E-06 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 0.150277103 | FZR = 1 |
| Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) | Not Specified Virus Region | RNA Info | ChIRP-MS | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) | . | Liver | 48 h | FDR <= 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | N region | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 cell line | . | Liver | . | P value < 0.05 | . |
| Influenza A virus (strain California/7/2004 (H3N2)) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 1 h | P = 0.000561153537758919 | . |
Potential Drug(s) that Targets This Protein
Protein Sequence Information
|
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Click to Show/Hide
|