Host Protein General Information

  Protein Name
14-3-3 protein epsilon
  Gene Name
YWHAE
  Host Species
Homo sapiens
  Uniprot Entry Name
1433E_HUMAN
  Protein Families
14-3-3 family
  Subcellular Location
Nucleus
  External Link
NCBI Gene ID
7531
Uniprot ID
P62258
Ensembl ID
ENSG00000108953
HGNC ID
12851
  Related KEGG Pathway
NOD-like receptor signaling pathway hsa04621            Pathway Map 
Hepatitis C hsa05160            Pathway Map 
Viral carcinogenesis hsa05203            Pathway Map 
Cell cycle hsa04110            Pathway Map 
Oocyte meiosis hsa04114            Pathway Map 
Neurotrophin signaling pathway hsa04722            Pathway Map 
PI3K-Akt signaling pathway hsa04151            Pathway Map 
Hippo signaling pathway hsa04390            Pathway Map 
  3D Structure
PDB ID: 2BR9 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -1.479472748 FZR = 1
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -0.237310852 FZR = 1
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) N region RNA Info RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) Calu-3 cell line . Liver . P value < 0.05 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver 28 h MIST = 2.98 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver 28 h . .

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
INSULIN . . D0R6CD  DGIdb

Protein Sequence Information

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
    Click to Show/Hide