Host Protein General Information

  Protein Name
Protein transport protein Sec61 subunit beta
  Gene Name
SEC61B
  Host Species
Homo sapiens
  Uniprot Entry Name
SC61B_HUMAN
  Protein Families
SEC61-beta family
  Subcellular Location
Endoplasmic reticulum membrane
  External Link
NCBI Gene ID
10952
Uniprot ID
P60468
Ensembl ID
ENSG00000086598
HGNC ID
16993
  Related KEGG Pathway
Vibrio cholerae infection hsa05110            Pathway Map 
Protein export hsa03060            Pathway Map 
Protein processing in endoplasmic reticulum hsa04141            Pathway Map 
Phagosome hsa04145            Pathway Map 
  3D Structure
PDB ID: 6W6L 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Dengue virus 2 5'UTR - 3'UTR RNA Info Genome-wide RNA interference (RNAi) screen HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Dengue virus 2 5'UTR - 3'UTR RNA Info Genome-wide RNA interference (RNAi) screen HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -6.099674672 FZR = 6.74907E-07
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -4.878050417 FZR = 0.00106711
Ebola virus (strain VeroVP30) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver . MIST = 0.685528865 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 1.320
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 0.991

Protein Sequence Information

MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
    Click to Show/Hide