Host Protein General Information
| Protein Name |
Ras-related protein Rab-1A
|
Gene Name |
RAB1A
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
RAB1A_HUMAN
|
||||||
| Protein Families |
Small GTPase superfamily, Rab family
|
||||||||
| EC Number |
3.6.5.2
|
||||||||
| Subcellular Location |
Golgi apparatus
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| Pathogenic Escherichia coli infection | hsa05130 |
Pathway Map
|
|||||||
| Legionellosis | hsa05134 |
Pathway Map
|
|||||||
| Amyotrophic lateral sclerosis | hsa05014 |
Pathway Map
|
|||||||
| Pathways of neurodegeneration - multiple diseases | hsa05022 |
Pathway Map
|
|||||||
| Autophagy - animal | hsa04140 |
Pathway Map
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus | 5'UTR - 3'UTR | RNA Info | UV cross-linking (UVX) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
| Dengue virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Zika virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -17.47751705 | FZR = 2.65906E-65 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -4.707501673 | FZR = 0.002424958 |
| Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 3 h | . | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 1 h | . | . |
| Chikungunya virus (strain 181/25) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | BHK-21 Cells (Small hamster kidney fibroblast) | . | Kidney | 0.2 h | . | . |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 1.362 |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 0.964 |
Protein Sequence Information
|
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
Click to Show/Hide
|
