Home
Search 
BLAST
Manual
DownloadHost Protein General Information
| Protein Name |
DAZ-associated protein 1
|
Gene Name |
DAZAP1
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
DAZP1_HUMAN
|
||||||
| Subcellular Location |
Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| Related KEGG Pathway | |||||||||
| mRNA surveillance pathway | hsa03015 |
Pathway Map 
|
|||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Dengue virus | 5'UTR - 3'UTR | RNA Info | UV cross-linking (UVX) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
| Dengue virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Rhinovirus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Zika virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -18.45506507 | FZR = 6.04886E-73 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -7.127951088 | FZR = 1.21E-09 |
| Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 30 h | . | . |
| Human coronavirus OC43 (strain hCov-OC43/VR-759 Quebec/2019) | Not Specified Virus Region | RNA Info | liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HCT-8 cells (Human ileocaecal adenocarcinoma cell) | . | Ileocecum | 12h; 24; 36h; 48h | p_value < 0.05; FDR < 10% | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) | Not Specified Virus Region | RNA Info | ChIRP-MS | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) | . | Liver | 48 h | FDR <= 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/South Korea/KCDC03/2020) | 5'UTR | RNA Info | Modified RNA antisense purification coupled with mass spectrometry (RAP-MS); label-free quantification (LFQ); liquid chromatography with tandem mass spectrometry (LC-MS/MS) | Vero cells (epithelial kidney cells) | . | kidney | 24 h | adj. p value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) | Not Specified Virus Region | RNA Info | ChIRP-M/S | HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) | . | Embryonic kidneys | 48 h | SAINT score >= 0.79 | . |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 1.649 |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 0.298 |
Protein Sequence Information
|
MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Click to Show/Hide
|