Host Protein General Information

  Protein Name
CTP synthase 1
  Gene Name
CTPS1
  Host Species
Homo sapiens
  Uniprot Entry Name
PYRG1_HUMAN
  Protein Families
CTP synthase family
  EC Number
6.3.4.2
  Subcellular Location
Cytoplasm; cytosol
  External Link
NCBI Gene ID
1503
Uniprot ID
P17812
Ensembl ID
ENSG00000171793
HGNC ID
2519
  Related KEGG Pathway
Metabolic pathways hsa01100            Pathway Map 
Nucleotide metabolism hsa01232            Pathway Map 
Biosynthesis of cofactors hsa01240            Pathway Map 
Pyrimidine metabolism hsa00240            Pathway Map 
  3D Structure
PDB ID: 2VO1 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -12.86821675 FZR = 7.37969E-35
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -6.260989739 FZR = 4.35E-07
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h . .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 1.050
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 0.881

Protein Sequence Information

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
    Click to Show/Hide