Host Protein General Information
| Protein Name |
Protein FAM98A
|
Gene Name |
FAM98A
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
FA98A_HUMAN
|
||||||
| Protein Families |
FAM98 family
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Poliovirus | 5'UTR - 3'UTR | RNA Info | Thiouracil cross-linking mass spectrometry (TUX-MS) | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | 5 h | . | . |
| Sindbis virus | 5'UTR - 3'UTR | RNA Info | comparative RIC | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 18 h | MIST = 0.08020303 | . |
| Dengue virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Zika virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 5.350766555 | FZR = 4.90462E-05 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -1.396889658 | FZR = 1 |
| Zika virus (strain MR766) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 20 h | MIST = 0.801481913 | . |
| Human coronavirus OC43 (strain hCov-OC43/VR-759 Quebec/2019) | Not Specified Virus Region | RNA Info | liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HCT-8 cells (Human ileocaecal adenocarcinoma cell) | . | Ileocecum | 12h; 24; 36h; 48h | p_value < 0.05; FDR < 10% | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/South Korea/KCDC03/2020) | 5'UTR | RNA Info | Modified RNA antisense purification coupled with mass spectrometry (RAP-MS); label-free quantification (LFQ); liquid chromatography with tandem mass spectrometry (LC-MS/MS) | Vero cells (epithelial kidney cells) | . | kidney | 24 h | adj. p value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | N region | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) | Not Specified Virus Region | RNA Info | ChIRP-M/S | HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) | . | Embryonic kidneys | 48 h | SAINT score >= 0.79 | . |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 1.877 |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 1.602 |
Protein Sequence Information
|
MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELEAARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKLKETLAKVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLLIKRLDVTVQSFGWSDRAKSQTEKLAKVYQPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMGRVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYRDSGFQPGGYHGGHSSGGYQGGGYGGFQTSSSYTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGWGGRGSQNYHQGGQFEQHFQHGGYQYNHSGFGQGRHYTS
Click to Show/Hide
|
