Host Protein General Information

  Protein Name
RNA-binding protein FUS
  Gene Name
FUS
  Host Species
Homo sapiens
  Uniprot Entry Name
FUS_HUMAN
  Protein Families
RRM TET family
  Subcellular Location
Nucleus
  External Link
NCBI Gene ID
2521
Uniprot ID
P35637
Ensembl ID
ENSG00000164327
HGNC ID
4010
  Related KEGG Pathway
mRNA surveillance pathway hsa03015            Pathway Map 
Spliceosome hsa03040            Pathway Map 
Amyotrophic lateral sclerosis hsa05014            Pathway Map 
Pathways of neurodegeneration - multiple diseases hsa05022            Pathway Map 
Transcriptional misregulation in cancer hsa05202            Pathway Map 
  3D Structure
PDB ID: 2LA6 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Poliovirus 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HeLa Cells (Human cervical carcinoma cell) . Cervix 5 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h MIST = 0.037668368 .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Rhinovirus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -7.353363435 FZR = 1.44187E-10
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -1.788321776 FZR = 1
Zika virus (strain MR766) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 20 h MIST = 0.983969488 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) Not Specified Virus Region RNA Info ChIRP-MS Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) . Liver 48 h FDR <= 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) N region RNA Info RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) Huh7 cell line . Liver . P value < 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) 3'UTR RNA Info PrismNet; pull-down western (STAR methods); mass spectrometry Huh7.5.1 cells . Liver 30 h Affinity = 0.88 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) Not Specified Virus Region RNA Info ChIRP-M/S HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) . Embryonic kidneys 48 h SAINT score >= 0.79 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) Not Specified Virus Region RNA Info UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) Calu-3 cells (Human lung cancer cells) . Lung 24 h adj.P.Val = 0.059 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 3.425
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 2.267

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
TRETINOIN . 444795  D02DGU  DGIdb

Protein Sequence Information

MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
    Click to Show/Hide