Host Protein General Information

  Protein Name
L-lactate dehydrogenase A chain
  Gene Name
LDHA
  Host Species
Homo sapiens
  Uniprot Entry Name
LDHA_HUMAN
  Protein Families
LDH/MDH superfamily, LDH family
  EC Number
1.1.1.27
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
3939
Uniprot ID
P00338
Ensembl ID
ENSG00000134333
HGNC ID
6535
  Related KEGG Pathway
Cysteine and methionine metabolism hsa00270            Pathway Map 
Central carbon metabolism in cancer hsa05230            Pathway Map 
Glycolysis / Gluconeogenesis hsa00010            Pathway Map 
Pyruvate metabolism hsa00620            Pathway Map 
Propanoate metabolism hsa00640            Pathway Map 
Glucagon signaling pathway hsa04922            Pathway Map 
Metabolic pathways hsa01100            Pathway Map 
HIF-1 signaling pathway hsa04066            Pathway Map 
  3D Structure
PDB ID: 1I10 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h MIST = 0.04945063 .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -11.55393967 FZR = 7.16406E-28
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -5.894998621 FZR = 4.18E-06
Zika virus (strain MR766) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 20 h MIST = 0.735084485 .
Influenza A virus (strain California/7/2004 (H3N2)) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 0.000315759740773665 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h P = 7.50689033564363e-05 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 6.73540564619623e-05 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h P = 0.000271562742147453 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 1.073
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 0.41 MIST = 0.000

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
adenosine phosphate . 6083  D06ACW  DrugCentral
gossypol . 3503  D0Z0HH  DrugCentral

Protein Sequence Information

MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
    Click to Show/Hide