Host Protein General Information

  Protein Name
RNA-binding protein 3
  Gene Name
RBM3
  Host Species
Homo sapiens
  Uniprot Entry Name
RBM3_HUMAN
  Subcellular Location
Nucleus
  External Link
NCBI Gene ID
5935
Uniprot ID
P98179
Ensembl ID
ENSG00000102317
HGNC ID
9900
  3D Structure
PDB ID: 7EB1 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Dengue virus 5'UTR - 3'UTR RNA Info UV cross-linking (UVX) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Rhinovirus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -5.513109403 FZR = 2.01305E-05
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -1.492098977 FZR = 1
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver . . .
Human coronavirus OC43 (strain hCov-OC43/VR-759 Quebec/2019) Not Specified Virus Region RNA Info liquid chromatography with tandem mass spectrometry (LC-MS/MS) HCT-8 cells (Human ileocaecal adenocarcinoma cell) . Ileocecum 12h; 24; 36h; 48h p_value < 0.05; FDR < 10% .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/South Korea/KCDC03/2020) 5'UTR RNA Info Modified RNA antisense purification coupled with mass spectrometry (RAP-MS); label-free quantification (LFQ); liquid chromatography with tandem mass spectrometry (LC-MS/MS) Vero cells (epithelial kidney cells) . kidney 24 h adj. p value < 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) Not Specified Virus Region RNA Info UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) Calu-3 cells (Human lung cancer cells) . Lung 24 h adj.P.Val = 0.012 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 1.769
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 0.000

Protein Sequence Information

MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
    Click to Show/Hide