Host Protein General Information

  Protein Name
Peroxiredoxin-4
  Gene Name
PRDX4
  Host Species
Homo sapiens
  Uniprot Entry Name
PRDX4_HUMAN
  Protein Families
Peroxiredoxin family, AhpC/Prx1 subfamily
  EC Number
1.11.1.24
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
10549
Uniprot ID
Q13162
Ensembl ID
ENSG00000123131
HGNC ID
17169
  3D Structure
PDB ID: 2PN8 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Dengue virus 5'UTR - 3'UTR RNA Info UV cross-linking (UVX) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = 2.414614571 FZR = 1
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = 0.482111535 FZR = 1
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Influenza A virus (strain California/7/2004 (H3N2)) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 0.00230936340178495 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h . .

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
DOCETAXEL . 148124  D0O5WP  DGIdb

Protein Sequence Information

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
    Click to Show/Hide