Host Protein General Information
Protein Name |
RNA-splicing ligase RtcB homolog
|
Gene Name |
RTCB
|
||||||
---|---|---|---|---|---|---|---|---|---|
Host Species |
Homo sapiens
|
Uniprot Entry Name |
RTCB_HUMAN
|
||||||
Protein Families |
RtcB family
|
||||||||
EC Number |
6.5.1.8
|
||||||||
Subcellular Location |
Nucleus
|
||||||||
External Link | |||||||||
NCBI Gene ID | |||||||||
Uniprot ID | |||||||||
Ensembl ID | |||||||||
HGNC ID | |||||||||
3D Structure |
|
Full List of Virus RNA Interacting with This Protien
Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
---|---|---|---|---|---|---|---|---|---|
Sindbis virus | 5'UTR - 3'UTR | RNA Info | comparative RIC | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 18 h | P = 0.708079945710355 | . |
Sindbis virus | 5'UTR - 3'UTR | RNA Info | comparative RIC | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 18 h | MIST = 0.024286793 | . |
Dengue virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Rhinovirus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Zika virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
Dengue virus 2 | 3'UTR | RNA Info | Protein-RNA reconstitution and a stringent RNA pulldown assay | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | . | . | . |
Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -11.38591357 | FZR = 4.92487E-27 |
Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -0.884928399 | FZR = 1 |
Zika virus (strain PRVABC59) | 3'UTR | RNA Info | Protein-RNA reconstitution and a stringent RNA pulldown assay | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | . | . | . |
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) | Not Specified Virus Region | RNA Info | ChIRP-MS | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) | . | Liver | 48 h | FDR <= 0.05 | . |
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | N region | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 cell line | . | Liver | . | P value < 0.05 | . |
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | 3'UTR | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 or Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | Not Specified Virus Region | RNA Info | RNAantisensepurificationandquantitativemassspectrometry(RAP-MS); Tandemmasstag(TMT)labelling; liquidchromatographycoupledwithtandemmassspectrometry(LC-MS/MS); Westernblot | Huh7 cells (liver carcinoma celll ine) | . | Liver | 24h | log2 fold change = 1.88722E+14 | . |
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) | 3'UTR | RNA Info | PrismNet; pull-down western (STAR methods); mass spectrometry | Huh7.5.1 cells | . | Liver | 30 h | Affinity = 0.928 | . |
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) | Not Specified Virus Region | RNA Info | ChIRP-M/S | HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) | . | Embryonic kidneys | 48 h | SAINT score >= 0.79 | . |
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) | Not Specified Virus Region | RNA Info | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) | Calu-3 cells (Human lung cancer cells) | . | Lung | 8 h | adj.P.Val = 0.025 | . |
Hepatitis B virus (strain ayw) | 5'UTR - 3'UTR | RNA Info | Co-immunoprecipitation mass spectrometry (Co-IP/MS) | HepaRG Cell (Human bipotent progenitor cell line) | . | Liver | 1 h | P-value (- Benzonase) = 4.65E-04 | . |
Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 3.194 |
Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 3.007 |
Protein Sequence Information
MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG
Click to Show/Hide
|