Host Protein General Information
| Protein Name |
Heterogeneous nuclear ribonucleoprotein A/B
|
Gene Name |
HNRNPAB
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
ROAA_HUMAN
|
||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Hepatitis C virus | 5'UTR - 3'UTR | RNA Info | Mass spectrometry (MS) | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | 1 h | . | . |
| Dengue virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Rhinovirus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Zika virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -3.374430538 | FZR = 0.274423436 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = 1.158581021 | FZR = 1 |
| Ebola virus (strain VeroVP30) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | MIST = 0.988651925 | . |
| Dengue virus 2 (strain NGC) | 5'UTR - 3'UTR | RNA Info | VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | . | . |
| Human coronavirus OC43 (strain hCov-OC43/VR-759 Quebec/2019) | Not Specified Virus Region | RNA Info | liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HCT-8 cells (Human ileocaecal adenocarcinoma cell) | . | Ileocecum | 12h; 24; 36h; 48h | p_value < 0.05; FDR < 10% | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) | Not Specified Virus Region | RNA Info | ChIRP-MS | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) | . | Liver | 48 h | FDR <= 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/South Korea/KCDC03/2020) | 5'UTR | RNA Info | Modified RNA antisense purification coupled with mass spectrometry (RAP-MS); label-free quantification (LFQ); liquid chromatography with tandem mass spectrometry (LC-MS/MS) | Vero cells (epithelial kidney cells) | . | kidney | 24 h | adj. p value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | N region | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | 5'UTR | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 or Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | 3'UTR | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 or Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | Not Specified Virus Region | RNA Info | RNAantisensepurificationandquantitativemassspectrometry(RAP-MS); Tandemmasstag(TMT)labelling; liquidchromatographycoupledwithtandemmassspectrometry(LC-MS/MS); Westernblot | Huh7 cells (liver carcinoma celll ine) | . | Liver | 24h | log2 fold change = 1.02149E+14 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) | 3'UTR | RNA Info | ChIRP-MS | Huh7.5.1 cells | . | Liver | 30 h | MIST = 0.98939755 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) | Not Specified Virus Region | RNA Info | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) | Calu-3 cells (Human lung cancer cells) | . | Lung | 24 h | adj.P.Val = 0.056 | . |
| Dengue virus 4 (strain DENV-4/SG/06K2270DK1/2005) | 3'UTR | RNA Info | RNA chromatography and quantitative mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 24 h | . | . |
| Dengue virus 2 (strain D2/SG/05K3295DK1/2005) | 3'UTR | RNA Info | RNA chromatography and quantitative mass spectrometry | HuH-7 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 1.852 |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 1.563 |
Protein Sequence Information
|
MSEAGEEQPMETTGATENGHEAVPEASRGRGWTGAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY
Click to Show/Hide
|
