Host Protein General Information

  Protein Name
Elongation factor 1-gamma
  Gene Name
EEF1G
  Host Species
Homo sapiens
  Uniprot Entry Name
EF1G_HUMAN
  External Link
NCBI Gene ID
1937
Uniprot ID
P26641
Ensembl ID
ENSG00000254772
HGNC ID
3213
  Related KEGG Pathway
Legionellosis hsa05134            Pathway Map 
  3D Structure
PDB ID: 1PBU 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h P = 0.940264882800393 .
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h MIST = 0.002704114 .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -8.164703977 FZR = 2.62291E-13
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -0.903937728 FZR = 1
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver . . .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) N region RNA Info RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) Huh7 cell line . Liver . P value < 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) Not Specified Virus Region RNA Info UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) Calu-3 cells (Human lung cancer cells) . Lung 24 h adj.P.Val = 0.037 .
Influenza A virus (strain California/7/2004 (H3N2)) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) A549 Cells (Adenocarcinoma human alveolar basal epithelial cell) . Lung . P-value = 1.00730642312423e-05 .
Influenza A virus (strain California/7/2004 (H3N2)) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 1.00730642312423e-05 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h P = 0.00218717334116256 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h P = 0.00136300719635549 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 0.000763565743491981 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 1.515
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 0.482

Protein Sequence Information

MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
    Click to Show/Hide