Host Protein General Information

  Protein Name
Peptidyl-prolyl cis-trans isomerase A
  Gene Name
PPIA
  Host Species
Homo sapiens
  Uniprot Entry Name
PPIA_HUMAN
  Protein Families
Cyclophilin-type PPIase family
  EC Number
5.2.1.8
  Subcellular Location
Cytoplasm
  External Link
NCBI Gene ID
5478
Uniprot ID
P62937
Ensembl ID
ENSG00000196262
HGNC ID
9253
  Related KEGG Pathway
Viral life cycle - HIV-1 hsa03250            Pathway Map 
Necroptosis hsa04217            Pathway Map 
  3D Structure
PDB ID: 1AK4 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Poliovirus 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HeLa Cells (Human cervical carcinoma cell) . Cervix 5 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h P = 0.57530942138671 .
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h MIST = 0.017236191 .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -9.846987272 FZR = 6.47671E-20
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -6.579685936 FZR = 5.44E-08
Zika virus (strain MR766) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 20 h MIST = 0.989660951 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) Not Specified Virus Region RNA Info RNAantisensepurificationandquantitativemassspectrometry(RAP-MS); Tandemmasstag(TMT)labelling; liquidchromatographycoupledwithtandemmassspectrometry(LC-MS/MS); Westernblot Huh7 cells (liver carcinoma celll ine) . Liver 24h log2 fold change = 8.76745E+13 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) 3'UTR RNA Info ChIRP-MS Huh7.5.1 cells . Liver 30 h MIST = 0.990602192 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) Not Specified Virus Region RNA Info ChIRP-M/S HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) . Embryonic kidneys 48 h SAINT score >= 0.79 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) Not Specified Virus Region RNA Info UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) Calu-3 cells (Human lung cancer cells) . Lung 24 h adj.P.Val = 0.012 .
Hepatitis B virus (strain ayw) 5'UTR - 3'UTR RNA Info Co-immunoprecipitation mass spectrometry (Co-IP/MS) HepaRG Cell (Human bipotent progenitor cell line) . Liver 1 h P-value (- Benzonase) = 1.37E-03 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h . .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 1.193
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 0.99 MIST = 0.855

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
ciclosporin . 24883466  D0O3YF  DrugCentral
PROLINE . . . DGIdb
SCY 635 . 6479267  D02EEJ  DGIdb
VOCLOSPORIN . 6918486  D0L9HX  DGIdb
voclosporin . 6918486  D0L9HX  DrugCentral

Protein Sequence Information

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
    Click to Show/Hide