Host Protein General Information

  Protein Name
RNA-binding motif protein
  Gene Name
RBMX
  Host Species
Homo sapiens
  Uniprot Entry Name
RBMX_HUMAN
  Subcellular Location
Nucleus
  External Link
NCBI Gene ID
27316
Uniprot ID
P38159
Ensembl ID
ENSG00000147274
HGNC ID
9910
  Related KEGG Pathway
Spliceosome hsa03040            Pathway Map 
  3D Structure
PDB ID: 2MB0 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Poliovirus 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HeLa Cells (Human cervical carcinoma cell) . Cervix 5 h . .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Rhinovirus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -5.555971049 FZR = 1.58466E-05
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -0.641356539 FZR = 1
Ebola virus (strain VeroVP30) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver . MIST = 0.986179959 .
Zika virus (strain MR766) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 20 h MIST = 0.960524134 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) Not Specified Virus Region RNA Info ChIRP-MS Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) . Liver 48 h FDR <= 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) N region RNA Info RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) Huh7 cell line . Liver . P value < 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) 3'UTR RNA Info ChIRP-MS Huh7.5.1 cells . Liver 30 h MIST = 0.879802712 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) Not Specified Virus Region RNA Info ChIRP-M/S HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) . Embryonic kidneys 48 h SAINT score >= 0.79 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) Not Specified Virus Region RNA Info UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) Calu-3 cells (Human lung cancer cells) . Lung 24 h adj.P.Val = 0.023 .
Hepatitis B virus (strain ayw) 5'UTR - 3'UTR RNA Info Co-immunoprecipitation mass spectrometry (Co-IP/MS) HepaRG Cell (Human bipotent progenitor cell line) . Liver 1 h P-value (- Benzonase) = 6.57E-05 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h . .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h . .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver 28 h MIST = 1.32 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver 28 h . .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 2.564
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 0.957

Protein Sequence Information

MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
    Click to Show/Hide