Home
Search 
BLAST
Manual
DownloadHost Protein General Information
| Protein Name |
Heterogeneous nuclear ribonucleoprotein D0
|
Gene Name |
HNRNPD
|
||||||
|---|---|---|---|---|---|---|---|---|---|
| Host Species |
Homo sapiens
|
Uniprot Entry Name |
HNRPD_HUMAN
|
||||||
| Subcellular Location |
Nucleus; Cytoplasm
|
||||||||
| External Link | |||||||||
| NCBI Gene ID | |||||||||
| Uniprot ID | |||||||||
| Ensembl ID | |||||||||
| HGNC ID | |||||||||
| 3D Structure |
|
||||||||
Full List of Virus RNA Interacting with This Protien
| Virus Name | Binding Region | RNA Info | Detection Method | Infection Cell | Cell ID | Cell Originated Tissue | Infection Time | Interaction Score 1 | Interaction Score 2 |
|---|---|---|---|---|---|---|---|---|---|
| Human immunodeficiency virus type 1 | 5'UTR - stem lops | RNA Info | Nano-liquid chromatographytandem mass spectrometry (nanoLC-MS/MS) | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | . | . | . |
| Coxsackievirus B3 | 3'UTR | RNA Info | Immunoprecipitation (IP) | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | 7 h | . | . |
| Poliovirus | 5'UTR - 3'UTR | RNA Info | Thiouracil cross-linking mass spectrometry (TUX-MS) | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | 5 h | . | . |
| Poliovirus | 5'UTR - stem lops | RNA Info | UV cross-linking (UVX) | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | 4 h | . | . |
| Sindbis virus | 5'UTR - 3'UTR | RNA Info | comparative RIC | HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) | . | Kidney | 18 h | MIST = 0.113262453 | . |
| Dengue virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Rhinovirus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Zika virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | . | . |
| Encephalomyocarditis virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -2.149743783 | FZR = 1 |
| Influenza A virus | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | Z-score = -0.366745642 | FZR = 1 |
| Ebola virus (strain VeroVP30) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | . | MIST = 0.986194597 | . |
| Poliovirus (strain type 1) | 5'UTR - 3'UTR | RNA Info | Nano-liquid chromatographytandem mass spectrometry (nanoLC-MS/MS) | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | 6.5 h | . | . |
| Zika virus (strain MR766) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 20 h | MIST = 0.952354154 | . |
| Human coronavirus OC43 (strain hCov-OC43/VR-759 Quebec/2019) | Not Specified Virus Region | RNA Info | liquid chromatography with tandem mass spectrometry (LC-MS/MS) | HCT-8 cells (Human ileocaecal adenocarcinoma cell) | . | Ileocecum | 12h; 24; 36h; 48h | p_value < 0.05; FDR < 10% | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) | Not Specified Virus Region | RNA Info | ChIRP-MS | Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) | . | Liver | 48 h | FDR <= 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/South Korea/KCDC03/2020) | 5'UTR | RNA Info | Modified RNA antisense purification coupled with mass spectrometry (RAP-MS); label-free quantification (LFQ); liquid chromatography with tandem mass spectrometry (LC-MS/MS) | Vero cells (epithelial kidney cells) | . | kidney | 24 h | adj. p value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | ORF10 | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 or Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | 5'UTR - L | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 or Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | 5'UTR | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 or Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) | 3'UTR | RNA Info | RNA pull-down assays; liquid chromatography with tandem mass spectrometry (LC-MS/MS); Wilcoxon test; MS2 affinity purification coupled with liquid chromatography-mass spectrometry (MAMS) | Huh7 or Calu-3 cell line | . | Liver | . | P value < 0.05 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) | 3'UTR | RNA Info | ChIRP-MS | Huh7.5.1 cells | . | Liver | 30 h | MIST = 0.937387276 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) | Not Specified Virus Region | RNA Info | ChIRP-M/S | HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) | . | Embryonic kidneys | 48 h | SAINT score >= 0.79 | . |
| Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) | Not Specified Virus Region | RNA Info | UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) | Calu-3 cells (Human lung cancer cells) | . | Lung | 24 h | adj.P.Val = 0.085 | . |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 2.190 |
| Dengue virus 2 (strain 16681) | 5'UTR - 3'UTR | RNA Info | Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) | HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) | . | Liver | 48 h | Saint score = 1 | MIST = 1.874 |
| Human rhinovirus (strain 16) | 5'UTR - 3'UTR | RNA Info | Nano-liquid chromatographytandem mass spectrometry (nanoLC-MS/MS) | HeLa Cells (Human cervical carcinoma cell) | . | Cervix | 16 h | . | . |
Protein Sequence Information
|
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
Click to Show/Hide
|