Host Protein General Information

  Protein Name
Heterogeneous nuclear ribonucleoproteins C1/C2
  Gene Name
HNRNPC
  Host Species
Homo sapiens
  Uniprot Entry Name
HNRPC_HUMAN
  Protein Families
RRM HNRPC family, RALY subfamily
  External Link
NCBI Gene ID
3183
Uniprot ID
P07910
Ensembl ID
ENSG00000169045
HGNC ID
5035
  Related KEGG Pathway
Spliceosome hsa03040            Pathway Map 
  3D Structure
PDB ID: 1TXP 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Poliovirus 5'UTR - 3'UTR RNA Info UV cross-linking (UVX) and liquid chromatography-tandem mass spectrometry (LC-MS/MS) HeLa Cells (Human cervical carcinoma cell) . Cervix . . .
Poliovirus 5'UTR - 3'UTR RNA Info UV cross-linking (UVX) and liquid chromatography-tandem mass spectrometry (LC-MS/MS) HeLa Cells (Human cervical carcinoma cell) . Cervix . . .
Poliovirus 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HeLa Cells (Human cervical carcinoma cell) . Cervix 5 h . .
Dengue virus 5'UTR - 3'UTR RNA Info UV cross-linking (UVX) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Dengue virus 5'UTR - 3'UTR RNA Info UV cross-linking (UVX) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h MIST = 0.07738307 .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -1.722514654 FZR = 1
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -2.311479366 FZR = 1
Ebola virus (strain VeroVP30) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver . MIST = 0.994046145 .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver . . .
Zika virus (strain MR766) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 20 h MIST = 0.866639342 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/USA/WA1/2020) Not Specified Virus Region RNA Info ChIRP-MS Huh7.5 cells (Hepatocyte derived cellular carcinoma cell) . Liver 48 h FDR <= 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) 3'UTR RNA Info PrismNet; pull-down western (STAR methods); mass spectrometry Huh7.5.1 cells . Liver 30 h Affinity = 0.977 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) 3'UTR RNA Info ChIRP-MS Huh7.5.1 cells . Liver 30 h MIST = 0.976760585 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) Not Specified Virus Region RNA Info ChIRP-M/S HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) . Embryonic kidneys 48 h SAINT score >= 0.79 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) Not Specified Virus Region RNA Info UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) Calu-3 cells (Human lung cancer cells) . Lung 24 h adj.P.Val = 0.007 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/England/02/2020) Not Specified Virus Region RNA Info UV protein-RNA crosslinking; RNA interactome capture (cRIC); RNA antisense purification coupled with mass spectrometry (RAP-MS) Calu-3 cells (Human lung cancer cells) . Lung 24 h adj.P.Val = 0.012 .
Hepatitis C virus (strain H77) 3'UTR RNA Info UV cross-linking (UVX) and immunofluorescence analyses (IFA) HepG2 Cells (Human Liver Cancer cell) . Liver . . .
Hepatitis B virus (strain ayw) 5'UTR - 3'UTR RNA Info Co-immunoprecipitation mass spectrometry (Co-IP/MS) HepaRG Cell (Human bipotent progenitor cell line) . Liver 1 h P-value (- Benzonase) = 1.16E-03 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 3.528
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 2.552

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
DABIGATRAN . 216210  D0M7JT  DGIdb

Protein Sequence Information

MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
    Click to Show/Hide