Host Protein General Information

  Protein Name
X-ray repair cross-complementing protein 5
  Gene Name
XRCC5
  Host Species
Homo sapiens
  Uniprot Entry Name
XRCC5_HUMAN
  Protein Families
Ku8. family
  EC Number
3.6.4.-
  Subcellular Location
Nucleus
  External Link
NCBI Gene ID
7520
Uniprot ID
P13010
Ensembl ID
ENSG00000079246
HGNC ID
12833
  Related KEGG Pathway
Non-homologous end-joining hsa03450            Pathway Map 
  3D Structure
PDB ID: 1JEQ 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Human immunodeficiency virus type 1 5'UTR - stem lops RNA Info Nano-liquid chromatographytandem mass spectrometry (nanoLC-MS/MS) HeLa Cells (Human cervical carcinoma cell) . Cervix . . .
Poliovirus 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HeLa Cells (Human cervical carcinoma cell) . Cervix 5 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h P = -1.24006194948587 .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Rhinovirus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -12.66743073 FZR = 9.63214E-34
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -4.708489151 FZR = 0.002415737
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Sindbis virus (strain Toto1101) 5'UTR - 3'UTR RNA Info Cross-link-assisted mRNP purification (CLAMP) and UV cross-linking and immunoprecipitation sequencing (CLIP-seq) HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 2 h . .
Zika virus (strain MR766) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 20 h MIST = 0.858236589 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) Not Specified Virus Region RNA Info RNAantisensepurificationandquantitativemassspectrometry(RAP-MS); Tandemmasstag(TMT)labelling; liquidchromatographycoupledwithtandemmassspectrometry(LC-MS/MS); Westernblot Huh7 cells (liver carcinoma celll ine) . Liver 24h log2 fold change = 1.68599E+14 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/France/IDF-220-95/2020) Not Specified Virus Region RNA Info ChIRP-M/S HEK 293T cells stably expressing the human ACE2 receptor (293T-ACE2) . Embryonic kidneys 48 h SAINT score >= 0.79 .
Influenza A virus (strain California/7/2004 (H3N2)) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 3.58593414603814e-05 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 0.00332705360642828 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h P = 0.000568219736892593 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h P = 0.000216018754846562 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 3.087
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 2.965

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
CAMPTOTHECIN . 24360  D09YDM  DGIdb
CISPLATIN . 5702198  D0U5HU  DGIdb
PHENYLBUTANOIC ACID . . . DGIdb
THALIDOMIDE . 5426  D0U7GK  DGIdb

Protein Sequence Information

MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
    Click to Show/Hide