Host Protein General Information

  Protein Name
Nucleophosmin
  Gene Name
NPM1
  Host Species
Homo sapiens
  Uniprot Entry Name
NPM_HUMAN
  Protein Families
Nucleoplasmin family
  Subcellular Location
Nucleus, nucleolus
  External Link
NCBI Gene ID
4869
Uniprot ID
P06748
Ensembl ID
ENSG00000181163
HGNC ID
7910
  3D Structure
PDB ID: 2LLH 
FASTA   Download
  2D PNG Download  
PDB File Download

Full List of Virus RNA Interacting with This Protien

Virus Name Binding Region RNA Info Detection Method Infection Cell Cell ID Cell Originated Tissue Infection Time Interaction Score 1 Interaction Score 2
Human immunodeficiency virus type 1 5'UTR - stem lops RNA Info Nano-liquid chromatographytandem mass spectrometry (nanoLC-MS/MS) HeLa Cells (Human cervical carcinoma cell) . Cervix . . .
Dengue virus 5'UTR - 3'UTR RNA Info UV cross-linking (UVX) HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Sindbis virus 5'UTR - 3'UTR RNA Info comparative RIC HEK293 Cells (Human embryonic kidney cell); Mesc cells (Embryonic stem cell) . Kidney 18 h MIST = 0.071154761 .
Dengue virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Rhinovirus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Zika virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h . .
Encephalomyocarditis virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -9.572937496 FZR = 9.38872E-19
Influenza A virus 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver . Z-score = -4.132743348 FZR = 0.031917603
Ebola virus (strain VeroVP30) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver . MIST = 0.685524627 .
Dengue virus 2 (strain NGC) 5'UTR - 3'UTR RNA Info UV cross-linking followed by antisense-mediated affinity purification and mass spectrometry HuH-7 Cells (Human hepatocellular carcinoma cell) . Liver 30 h . .
Zika virus (strain MR766) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 20 h MIST = 0.850239891 .
Human coronavirus OC43 (strain hCov-OC43/VR-759 Quebec/2019) Not Specified Virus Region RNA Info liquid chromatography with tandem mass spectrometry (LC-MS/MS) HCT-8 cells (Human ileocaecal adenocarcinoma cell) . Ileocecum 12h; 24; 36h; 48h p_value < 0.05; FDR < 10% .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/South Korea/KCDC03/2020) 5'UTR RNA Info Modified RNA antisense purification coupled with mass spectrometry (RAP-MS); label-free quantification (LFQ); liquid chromatography with tandem mass spectrometry (LC-MS/MS) Vero cells (epithelial kidney cells) . kidney 24 h adj. p value < 0.05 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/Not Specified Virus Strain) Not Specified Virus Region RNA Info RNAantisensepurificationandquantitativemassspectrometry(RAP-MS); Tandemmasstag(TMT)labelling; liquidchromatographycoupledwithtandemmassspectrometry(LC-MS/MS); Westernblot Huh7 cells (liver carcinoma celll ine) . Liver 24h log2 fold change = 1.26883E+13 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) 3'UTR RNA Info PrismNet; pull-down western (STAR methods); mass spectrometry Huh7.5.1 cells . Liver 30 h Affinity = 0.979 .
Severe acute respiratory syndrome coronavirus 2 (strain hCoV-19/IPBCAMS-YL01/2020) 5'UTR RNA Info PrismNet; pull-down western (STAR methods); mass spectrometry Huh7.5.1 cells . Liver 30 h Affinity = 0.93 .
Influenza A virus (strain California/7/2004 (H3N2)) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 0.000469195752839045 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 3 h P = 0.00121517469205271 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 0.2 h P = 0.000537925517173063 .
Chikungunya virus (strain 181/25) 5'UTR - 3'UTR RNA Info VIRal Cross-Linking And Solid-phase Purification (VIR-CLASP) BHK-21 Cells (Small hamster kidney fibroblast) . Kidney 1 h P = 0.000246369492456674 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver 28 h MIST = 2.29 .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Thiouracil cross-linking mass spectrometry (TUX-MS) HuH-7.5 Cells (Human hepatocellular carcinoma cell) . Liver 28 h . .
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 1.889
Dengue virus 2 (strain 16681) 5'UTR - 3'UTR RNA Info Comprehensive identification of RNA-binding proteins by mass spectrometry (ChIRP-MS) HuH-7.5.1 Cells (Human hepatocellular carcinoma cell) . Liver 48 h Saint score = 1 MIST = 1.649

Potential Drug(s) that Targets This Protein

Drug Name DrunkBank ID Pubchem ID TTD ID REF
ALECTINIB . 49806720  D0U3SY  DGIdb
ASP-3026 . 25134326  D09GEK  DGIdb
CERITINIB . 57379345  D04LVK  DGIdb
CHEMBL3397300 . 57390074  D0O9PQ  DGIdb
CRIZOTINIB . 11626560  D03ZBT  DGIdb
DEGUELIN . 107935  D14NDZ  DGIdb
ENMD-2076 . 16041424  D0S7HM  DGIdb
ENTRECTINIB . 25141092  D0O0LS  DGIdb
IXAZOMIB . 25183872  D0Y2SW  DGIdb
LORLATINIB . 71731823  D0AF6O  DGIdb
MIDOSTAURIN . 9829523  D07NVU  DGIdb
TRETINOIN . 444795  D02DGU  DGIdb
VENETOCLAX . . . DGIdb
VORINOSTAT . 5311  D0E7PQ  DGIdb

Protein Sequence Information

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
    Click to Show/Hide